PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA034366-PA
Common NameOsI_35406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 430aa    MW: 44443.4 Da    PI: 7.4807
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA034366-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.21.1e-18362395134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       Cs+Cgt++Tp+WR gpdg+ tLCnaCG++ +  +
  BGIOSGA034366-PA 362 CSHCGTSETPQWRMGPDGPGTLCNACGIRSKMDR 395
                       *****************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011413.231356394IPR000679Zinc finger, GATA-type
SMARTSM004014.7E-17356406IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.13E-14358419No hitNo description
Gene3DG3DSA:3.30.50.102.0E-15360395IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.53E-16361417No hitNo description
PROSITE patternPS003440362387IPR000679Zinc finger, GATA-type
PfamPF003201.7E-16362396IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MPKPTPSSSS FLDFTGGVDG DDDDPSCPFE GLCCPDDPLD QVLNFDSSDF GHVFFESLDV  60
ELFLPRGGPS RGAGEEDSKG AVERVAFGSS AAVESELGGV GGGGAGSEVS VPGGAGGGRG  120
EDMETEALDV KPVVGVGAGG AMGAHVAGGV GAPGAFPESK QLVPWPCAVG AGASAPGAAP  180
DNRLLALPDV RFDALTAEGA APGGERGKTI PDSVSKNGLP TLPGVRSATP TAPPATPFRL  240
EWDHAAAPSS SATTTPSDSS LSSPPSLSSV FPRIARVFPS RTKPRRRRTL RRQHWSLICP  300
LHLVPVAAAA RGKSISELNA SASASAGTDA GTPSINDGGG GSYHRRVVGR QRNRQVRKDR  360
RCSHCGTSET PQWRMGPDGP GTLCNACGIR SKMDRLLPEY RPSTSPSFNG DEHSNRHRKV  420
LKLREKKGRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0IZ780.0A0A0E0IZ78_ORYNI; Uncharacterized protein
TrEMBLA2ZC960.0A2ZC96_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA034366-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127772434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.14e-26GATA transcription factor 7